SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002829 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002829
Domain Number 1 Region: 132-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 177-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 37-88
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000037
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 93-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000432
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 2-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000084
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002829   Gene: ENSORLG00000002284   Transcript: ENSORLT00000002830
Sequence length 229
Comment pep:novel chromosome:MEDAKA1:18:547639:548325:1 gene:ENSORLG00000002284 transcript:ENSORLT00000002830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWIHVVDKPYKCDVCPKSFGLKAQLTAHKKAHAGKDQYHCNICNKQVYDRRSLTRHKMTH
SGERRFSCQVCGKRFKLPGTLKAHEKTHTVRDRPFLCHMCCKTFLSSCSLVAHMKTHSGE
RPFVCAVCSRGFLTNEALKKHLRVHTGEAPYDCKHCGRFFKLKSTLNSHIRSHLGIKRFT
CGVCGKACSRQEHLTVHMRTHNGERPYKCSQCDKAFTQSHCLKSHMRSH
Download sequence
Identical sequences H2LAC2
ENSORLP00000002829 8090.ENSORLP00000002829 ENSORLP00000002829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]