SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002938 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002938
Domain Number 1 Region: 197-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-16
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 230-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000467
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002938   Gene: ENSORLG00000002366   Transcript: ENSORLT00000002939
Sequence length 266
Comment pep:novel chromosome:MEDAKA1:2:20885263:20904037:1 gene:ENSORLG00000002366 transcript:ENSORLT00000002939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTCLELERYLQTEPKRLSELFDQDLDGLLTPAYLKEDGDEELADSLLPSLPGLAEPPSPL
PAHLFSKRKISPSGTTRELKPKGQVHENVEGMEGVHQAQLSAVTSLTPPSSPELGRHLVK
PNQTLTASADGTLTLKLVARKVGLGTARLVAGHTLPVRMKEEEDGAAYAIGVGELPENKK
RVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGA
KPFKCNHCDRCFSRSDHLALHMKRHI
Download sequence
Identical sequences H2LAM6
8090.ENSORLP00000002938 ENSORLP00000002938 ENSORLP00000002938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]