SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003001 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003001
Domain Number 1 Region: 625-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000424
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 515-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000435
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 3 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000109
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003001
Domain Number - Region: 336-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000175
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number - Region: 757-781,815-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00043
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 206-320
Classification Level Classification E-value
Superfamily SET domain 0.00948
Family Histone lysine methyltransferases 0.044
Further Details:      
 
Domain Number - Region: 684-742
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.0101
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003001   Gene: ENSORLG00000002416   Transcript: ENSORLT00000003002
Sequence length 1121
Comment pep:novel chromosome:MEDAKA1:13:4294044:4306257:1 gene:ENSORLG00000002416 transcript:ENSORLT00000003002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKQEPSAVWSQAVNDSNNTAQVHFEGGTVAQIVYSGEQADRGEQQVVYTADGNSYTSV
EPAEHTLVYIHPADGTQAVFSDQPQVAYIQQDGTTQQVSQPAQTLQDSSKLENSRSIHSL
GNPLGTADSTDDYEEDEDEDSEMDDWEPRQLEAFNPQNLWCEECNNTNPSVCLLHGPLHP
IHNRPVLSRARASLPLVLYVDRFLGGVFSKRRIPKRTQFGPVEAPLRPQSELQDHYIHLK
LCKLDSEKDAQTSDDLWLDLSDEDSCNWMMFVRPARNHLEQNLVAYQYGSDLFYTTIKNI
QPKQELKVWYAASYAEFVNQKIHDVTEEEIKVLREQEKNWPCYECNRRFVSSEQLQQHLN
MHDDKLSSASRSRGRGRGRGRKRFGTGRRPGRPPKFIRLDPPADASEDKTTVEEMLELTE
KPLEEREEGAQNGLKEVETETEAEPDAEGEGPLAPPAGDPAPESAMPPATTNVPLKDDPA
QDSQSERHVTPQDMQRAKRIRNAALQHLFIRKSFRPFKCPHCGKAFRDKDRLEQHLRVHG
RDAYSFSCHICSKSFLSDSSLEDHLLLHSENRSFSCLLCPETFERVELLKEHVEVHSVNG
SYTCPSCKKTFSDFIQVKKHIRCFHSEKIFQCSDCEKAFCRPDKLRLHMLRHSDRKDFLC
STCGKQFKRKDKLREHMQRMHNPDREAKKADRIHRSKSLKMKVPTTDFESFMFKCRMCMM
GFRRRGMLVNHLSKRHPEMRIDEVPELTLPIIKPNRDYFCQYCDKVYKSASKRKAHILKN
HPGAELPPSIRKLRPAAPGEPDPMLSTHTQLTGTIATSPVCCPHCAKQYSSKTKMVQHIR
KKHPELAQLGSGMQAPLTAAVISSAPAVISADGATAEAVVTTDLLTQAMTELSQTLTTDY
RTAQGDYQRIQYIPVSQAGGSLAQSQHIQLQVVQVAPASSPHSQAPTVDVSQLHDPHGYS
QQPIQLQHVQVSEASGTSQATAQGTSRPLSPTTQQASQELTPVTLAQSQSSSQQQGTVQH
TYIPGNWNYRGYTSEIQMMTLPHTQYVIAEASTPVSGVGSNQVKTTHYVISEGQTDLETK
QAAPQSAAQTEHLEQQPVTQQYIITTTTNGSGAGEVHITKP
Download sequence
Identical sequences H2LAT6
ENSORLP00000003001 ENSORLP00000003001 8090.ENSORLP00000003001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]