SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003111 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003111
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily POZ domain 3.14e-28
Family BTB/POZ domain 0.00095
Further Details:      
 
Domain Number 2 Region: 423-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000749
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003111   Gene: ENSORLG00000002503   Transcript: ENSORLT00000003112
Sequence length 496
Comment pep:novel chromosome:MEDAKA1:10:7866652:7869101:-1 gene:ENSORLG00000002503 transcript:ENSORLT00000003112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPQHSQQLLSALRSQRQRGFLCDCTVLVGSSRFLAHRAVLASCSPFFHMFYSDSPGGN
GSSTSCVTLDNDIVTSSAFGLLLDFIYEGVLQLDESPPVEDILAAASFLHMNEVVRVCKK
RLQRRGPLAEADSTRSEEDSKLKKANETGREGDYGAEPMMANAANHSYSVTSRAKSSGAY
KVRIQTPLSPDLADTTQPGMGVSRLPSGTGNQGQGSVLSSPCSSTEMHSLSEYCLSAGLP
PEESLLPQEDSTEDLSETDSRDTAGRGQQMIMDTSASPARKERSYFPTHVARTNREGDAG
KVKVEAIVISDEELEEERDESREREPVTDEELEFEDEIQEEELNSPQFVSSHQQDSVPAT
SCVNNFSIPLSPSSSSSSGPRPFSQDNVSLTASLAPLATSNQHSDTPAYFQDSMGNFVED
VPTCGVCGKTFSCTYTLRRHAIVHTRERPYQCRYCYRSYTQSGDLYRHIRKAHDHTLPAK
RSKTDTEPSLQPQPPP
Download sequence
Identical sequences H2LB43
ENSORLP00000003111 8090.ENSORLP00000003111 ENSORLP00000003111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]