SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003128 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000003128
Domain Number - Region: 204-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00733
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 149-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0159
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number - Region: 3-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0377
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 368-384
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0397
Family Autophagin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003128   Gene: ENSORLG00000002520   Transcript: ENSORLT00000003129
Sequence length 592
Comment pep:novel chromosome:MEDAKA1:16:1434357:1442455:-1 gene:ENSORLG00000002520 transcript:ENSORLT00000003129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTCEVCGEELLLEEDMKTHLLLVHLEADLHCPLCFLSAVSYDQLHAHMSTAHPEEQHNH
PKPLNSTFARTSTSKVPMGQPAGTPAEKEKSIRASTLVNLKPQEQEIPPDPEHAGPLSAT
LSAEEPETSQESDRNQARQLWSSGGRPGTFQMLEHSGEPNLSCPMCALVCTSPLVLQEHV
ELHLEEQHPEKELKSTLKTDRRRRPWECPMCSAECADSAALQEHVELHLDPCTANLHLSP
GRSSSDLSLAVQLQQEEEQHRRREEARQEAEHFKKLQRRYGLDGSGGYRRQMERTMEREV
SRGRLAPADFHRKKADLMESLTSGVDDGRSRTCGAVDALTEYYRTPACDCAHVWLCSDTD
HFGASAGDKGWGCGYRNFQMLLSSLHRTEPYASSLQARPEKAVPSIPQVQRMIEEAWKAG
VDPQGASHFNHRLQGTRAWIGATEIYVLLTWLGVRARIIDFHQPTGPGDTHPRLFDWVRQ
YFLQSSQSNRLPPKVIRTSLPPLYLQHQGHSRLVVGVEQRKSGALALLVMDPGSKLSLST
DAVSVAIRHIRKFPSSLKHKQYQLLAVQGVLSAEDKQAAVFNSRTLCAEKIP
Download sequence
Identical sequences H2LB59
ENSORLP00000003128 ENSORLP00000003128 8090.ENSORLP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]