SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003173 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000003173
Domain Number - Region: 334-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00117
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003173   Gene: ENSORLG00000002552   Transcript: ENSORLT00000003174
Sequence length 454
Comment pep:novel chromosome:MEDAKA1:12:3182013:3183733:1 gene:ENSORLG00000002552 transcript:ENSORLT00000003174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLQLDAKKSPLALLAQTCSQIGKPDPPCSKLSSSCSQGDKESASRSSASGLKLGEHRPS
LDDKSSFKPYSKGGGECRSVGGSEKAGFRVTSSNNATTNGGSGQPPCPPHAASPGCRGVS
TPPGQQLHKQTHSPAGAAGSQGGDAAREQNANSSHARASTNCSTGSSDGGSNPDKAESGQ
PGLGAGHATPISPFKSSQQLFPLPPSTMGYQGAVMGGYAGYQFAPSLDASKSSLGVGGMG
GKHPNSSPLTGASPPSFMQGLCRDPYCLSYPSMPHLGGCNSCIHDPSSPSESYPMVYPSH
PLSLHQGSLSSSVSSSLSHPLYSYGFMLPNDPLPHACNWVSAGGPCDKRFATSDELLAHL
RTHTALTMDSKLLSVSSSGPASCHLHLPHQSSSGSMPGSLSLRGPPSLGLARYHPYSKVH
LPSGHSPISLPGPYYPHYTFYSQRLGSASALGYQ
Download sequence
Identical sequences H2LBA3
ENSORLP00000003173 ENSORLP00000003173 8090.ENSORLP00000003173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]