SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003329 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003329
Domain Number 1 Region: 92-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 380-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000813
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000003329
Domain Number - Region: 67-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0139
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003329   Gene: ENSORLG00000002674   Transcript: ENSORLT00000003330
Sequence length 433
Comment pep:known chromosome:MEDAKA1:1:10336431:10347255:1 gene:ENSORLG00000002674 transcript:ENSORLT00000003330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEEVEGGSEEEFDEERMEEDNDEEQDMEGDEEGDSLNNPEDLSLVDYSRYEDPNLPNPAT
EPSHVTEAGPPRVQSQGKLSCDICGLSCISINVLLVHKRSHTGERPFHCSQCGASFTQKG
NLLRHIKLHSGEKPFKCPMCSYACRRRDALSGHLRTHSVEKPFKCNHCSRSYKQRSSLEE
HRERCHVYIQSKAGAEREDSHTSRSQMGPERALLLDRLASNVAKRKSSMPQKFTGDNGVC
LDLSFNRDLVHRSDVKEHPPGSPGSNGQLGSIFSGLDSDPPPSHRSYPIPLNRTDIITNG
HKMGMPPLGLPLGSQPPVSLDSFHPDGSQMSQPVVYSLGPLLGGGLSHQNGIPQPMSLSP
LEAMRLMRADGEAGVPSGSVYPCGHCRVIFLDYVMFTIHMGCHGFRDPLECNVCGHRSRD
RYEFSSHIARGEH
Download sequence
Identical sequences H2LBQ2
8090.ENSORLP00000003329 ENSORLP00000003329 ENSORLP00000003329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]