SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003488 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003488
Domain Number 1 Region: 190-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 246-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 165-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000261
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003488   Gene: ENSORLG00000002797   Transcript: ENSORLT00000003489
Sequence length 308
Comment pep:novel chromosome:MEDAKA1:16:2216745:2218018:-1 gene:ENSORLG00000002797 transcript:ENSORLT00000003489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKALHAPIPLHPALQLTNYSFLQAVNTFPADQLQGLYGLSAVQTMHMNHWTLGYPHMQ
GLRSTITAAAQGLVDPRIPFPALPFTAAQLFHPKQAGVTHGVPSLHKDRPRFDFANLALA
ATQEDPPKASDLAKLASGLGGTISELSKLSPDRKPTRGRLPSKTKKEFICKFCGRHFTKS
YNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLA
VHRTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCGRCGKVFRRNCDLRRHSL
THSPHQDY
Download sequence
Identical sequences H2LC54
ENSORLP00000003488 8090.ENSORLP00000003488 ENSORLP00000003488 XP_004077668.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]