SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003490 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003490
Domain Number 1 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 218-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000186
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003490   Gene: ENSORLG00000002799   Transcript: ENSORLT00000003491
Sequence length 757
Comment pep:known chromosome:MEDAKA1:8:5004373:5009068:-1 gene:ENSORLG00000002799 transcript:ENSORLT00000003491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNFGAGMIMFSHLPPVTSFTRLAAHTVMQDLPPQEMVFKKERDSPDCSVVTQRANLGV
GDYVHALGIKQEKQSEHDYRLPLYPGGLGKSTGLLGETISSNQNLLVHDLNMSSQLPSQL
EKEATGRKGRRSNGDGQEGKPRKRRGDAKKSTLYERDGGSLSPGSKPHICEHCAAAFRSS
YHLRRHVLIHTGERPFRCSQCNMSFIQKYLLQRHEKIHSGEKPFSCDQCNMRFIQKYHME
RHKRTHSGEKPYRCESCQQYFSRTDRLLKHKRTCGDGVRKGLEPGMMDLDCMNVGQGSYG
ITQGNAGRKKGRSRNSGEGEERKKKKGDGRELQMHGSVSGGYGVHEYSGEDQAVSSSTEP
GPSSQQGRAPKKASRKGPGKAATQQAKAGSLEQDGVMGDLGLLQGNEAKVESTSSNYDDA
MQFLKKRRYLQAANAAGHQSSEYDIHLSSQPSVTQGGLSNVLESDAPLSLDKSGIPDEVL
QSLLDHYSQKPGGGHADMHFDLSDQHVELAPTAASSPDISTSDKSVMMNEYSRFLLQALE
RTSHSFSMGPGPPPSGPFTSSHPGNPLFADKSIYTLSPLECGFGPAVASPSLPSSVPKSH
FAMLTGSSPQHCFHLSLEAPTHQQLTPSQELTEQMEKHQASTPPSSYQISPSELSGRKDQ
PPLKSGSPAVYTLVSSQDLTSLDSSKTSYQIENFAQAFGSQFKSNGHSLSFGTDSSGDVD
HRIRTPVSEFSGYSSLLSDVNEPVSTGSSTPTSQSYR
Download sequence
Identical sequences H2LC56
ENSORLP00000003490 ENSORLP00000003490 8090.ENSORLP00000003490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]