SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003786 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003786
Domain Number 1 Region: 68-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.99e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 95-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000031
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003786   Gene: ENSORLG00000003032   Transcript: ENSORLT00000003787
Sequence length 169
Comment pep:known chromosome:MEDAKA1:16:2497681:2498516:1 gene:ENSORLG00000003032 transcript:ENSORLT00000003787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLVPPPAATLYVQQTPATSGGTKFVAIAPAPCGSPSKQRPSPQQIGVVRVRRHACPQED
CGKTYFKSSHLKAHIRTHTGEKPFRCKWEGCKRQFARSDELSRHRRTHTGEKKFSCPVCL
TRFMRSDHLAKHTRRHLSARKTPCWAFGISQSVDLTAGSPTVFSLSVRK
Download sequence
Identical sequences H2LCZ1
8090.ENSORLP00000003786 ENSORLP00000003786 ENSORLP00000003786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]