SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003843 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003843
Domain Number 1 Region: 366-448
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.04e-29
Family Forkhead DNA-binding domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 209-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000833
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003843   Gene: ENSORLG00000003081   Transcript: ENSORLT00000003844
Sequence length 576
Comment pep:novel chromosome:MEDAKA1:5:4992801:5038798:1 gene:ENSORLG00000003081 transcript:ENSORLT00000003844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQL
HLQLLQQQHAGSKHTKESSSQLTAFTVTLELVCDTLHVSHVRSVSNVPLSSLQSFRTAVL
HSDLFVSGVFPAELQQLWKEVTSAHVKEEHNNNSTNGHRGLDLSSPVPPKNPLLNQHVST
NGQYASHKREGSAQEECSPSSHPLYGHGVCKWPGCEEVFDDFQSFIKHLNNEHALDDRST
AQCRVQMQVVQQLELQLAKDKERLQAMMTHLHVKSTEPKAPPQPLNLVSSVTLSKSAPEA
SPPLSLPQTPTTPTAPLTPLSQTHSVITPNSLHNVGSIRRRYSEKYNMPISPDLSQNKEF
YMNADVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLS
LHKCFVRVENVKGAVWTVDEIEFQKRRPQKISGSPALVKNIQSSLGFGPNLSAAFQASVA
ENNIPLYTTASIGSPTLNCLANAIHEEMNGAMDHGNSNGSDSSPGRSPLPAMHHISVKEE
PLDPEDHDGPLSLVTTGNHSPDFDHHRDYDEEQSVM
Download sequence
Identical sequences H2LD45
ENSORLP00000003843 ENSORLP00000003843 8090.ENSORLP00000003843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]