SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003975 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003975
Domain Number 1 Region: 618-685,949-1290
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-112
Family Ras GEF 0.0000149
Further Details:      
 
Domain Number 2 Region: 221-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-43
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 23-130
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-16
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 4 Region: 431-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000951
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003975   Gene: ENSORLG00000003190   Transcript: ENSORLT00000003976
Sequence length 1293
Comment pep:novel chromosome:MEDAKA1:9:6058511:6111051:1 gene:ENSORLG00000003190 transcript:ENSORLT00000003976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSAVARKEGTKRGFLSKKTTENSRWHEKFFALYQNILFYFENEQSA
RPAGIYLIRENPCRVQSSLFSLTKNSSSSANPHYFLIVFGHDGQKPLELRTDEESECDEW
VEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKSEIVA
LNKTKERMRPYHVYHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIDCTLIEEPDANDEESKAGG
QVFGQLDFKLVVEPSDLPSFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNT
FLHTYRIFTTATVVMDKLADIYKKPFSSIPIRSLELFFATNQNNRSGEHINDRSPRLCRK
FSSPPPLCIPSRTNSPVRTRKLSLHSPITARVIGLDLTSPLSNFSLDHNSSQSAASSPTS
VATPQTPTPQTPTPTTTSPSPPSSTSPPPNNGKPQQEQAPLTPSSPEQSPSSTIEGEEVP
RIDPFCGKLRRSIRRSIIIPESPQSSEAGDTSPCRSPSTPRHLRYRQPGGKTDNTCARMG
SYSWFHSIQSGENSRCSVSPASAFAIATAAAGHGTPPVALLRGATTQFHRVFTNSERTCD
KDFIIRRAATNRVLNVLRHWVSKHSQVLCNELNTQVFTLLLSSKYFKYFSSIYKNYTKIL
KCMSLALSQDEQEDAQLRIEDILQMADCLKAECFESLSAMELAEQITLLDHIVFRSIPYE
EFLGQGWMKVDKTDRTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRASSIEKWVAVADIC
RCLNNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLK
NCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEH
QVKVTQYLLDKTLTMDEDTLYDLSLKIEPRLPA
Download sequence
Identical sequences H2LDH0
ENSORLP00000003975 ENSORLP00000003975 8090.ENSORLP00000003975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]