SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004008 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004008
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000622
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004008   Gene: ENSORLG00000003219   Transcript: ENSORLT00000004009
Sequence length 329
Comment pep:novel chromosome:MEDAKA1:11:6414194:6415414:1 gene:ENSORLG00000003219 transcript:ENSORLT00000004009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSYSCEHCDFHTAEASLLRSHQHTQHLGFSSKQSPVLNNVSRSSSKSSKYMDYLRSRSV
LLSQPYWNICTYLPDQDTIKLSLSVSGDKCSMNCPVKAEDLVRHQCPYCSHNTNYPEVLW
IHQRVSHKVDSKSSAAPKWAPCMNSIKSSKAGACQWRRTGPPPFLEGKDCPSLPGPRTQR
TLPPGVTSQGSSKHLTTKSKPHPTSSLKHRGNMAPEEGIFPQEGLGFMLAKNHSGTSSNT
DRHYTRRKSCEFSSGLKAPDLWSTMNMWRLSGGKTYLDPLLFAQGNSESTGERPADMDIF
SLLKSYSPHDLAALYQHWGFIDPRLDPQG
Download sequence
Identical sequences H2LDK0
ENSORLP00000004008 ENSORLP00000004008 8090.ENSORLP00000004008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]