SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004020 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004020
Domain Number - Region: 901-975
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000324
Family Homeodomain 0.018
Further Details:      
 
Domain Number - Region: 327-351,432-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 1055-1083
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00397
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 947-1016
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0431
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004020   Gene: ENSORLG00000003228   Transcript: ENSORLT00000004021
Sequence length 1096
Comment pep:novel chromosome:MEDAKA1:11:6552859:6557186:-1 gene:ENSORLG00000003228 transcript:ENSORLT00000004021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQLQPTVAWQSFFAYGPEDDLKLDKTEEEEHLQDDGLSLDGQDGEFLFNDDEDPKDRF
SCQNSPLSNGTNPDAGYASPLSTTSDQLVDLKTTTSTFSDQDRIEEKLEDGSESINSLSL
QDSLAKMKAVYANMISDGSWSSIALDVFKTTNGSGSDHKGSNGLLNNHSSGGINAKNRCS
SNNTAATTNITTSSTSTRMASSHSSNGINVSSSGTGGLTYDWHQAALAKTLQHTPYQLLP
EPSLFSTVQLYRQNNKLYGPVFTGASKFRCKDCSAAYDTLVGLTVHMNETGHYRDDNKDS
EDDRSKKWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLK
EPMPALTSKLVPPSKKKVFQELISPSSPESVSSGILLGESPKDQKVVNPYVTPNNRYGYQ
NGASYTWQFEARKAQILKCMECGSSHDTLQQLTAHMMVTGHFLKVTNSASKKGKQLVFDP
LIEEKIQSIPLPPTTARLPAADGLSPLNSLSQLSGHEEKHEEIRQEEKEQKKYGVEHTEK
KIKEEKEDLSEKTEKPVKARSYQYLREEDLEETPKGGLDILKSLENTVSSAISKAQTGTP
TWGGYPSIHAAYQLHGSLKPTLPSSPQVQPLFSSTSLKVRSTDTSSLIHSPHSPSPPPSQ
KSNVVAMEELVEKVTGRSSVKTEKEEKSLENKCRSSKSPLPSPKDKQVSPNPENLLKTVK
GSVGEQTEPKDKEKSKTKIDVKIKRESDSPKATMSNGCNNLNIITNRMPEPPLVSPLSAL
QSVMNNHLGKASKAVTSSMDPFAMLYKMSNTPQSKQTEPISQYPDNDDDQPMDLTKSKSG
NRTTAKSQSSSPPLRENALMDISDMVKNLTGRLTPKSTTPSSVSEKSDNDGCSLEDSMEE
LSPVQRRKGRQSNWNPQHLLILQAQFASTLRETPEGKFVINDLGPQERVHICKFTGLSMT
TISHWLANVKYQLKRTGGTKFLKNIDSAQPLFLCSDCASQFRSPSSYIHHLESHLGFTLQ
DLSKLSIDLLEQQAVSRLEDKTFDSSGNADEDASSVYQCKLCNRTFVSKHAIKLHLCKTH
GKSTEDHLIFVKELDK
Download sequence
Identical sequences H2LDL2
ENSORLP00000004020 8090.ENSORLP00000004020 ENSORLP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]