SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004035 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004035
Domain Number 1 Region: 684-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000223
Family C2HC finger 0.015
Further Details:      
 
Domain Number 2 Region: 547-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000351
Family C2HC finger 0.027
Further Details:      
 
Domain Number 3 Region: 845-876
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000858
Family C2HC finger 0.014
Further Details:      
 
Domain Number 4 Region: 247-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000022
Family C2HC finger 0.021
Further Details:      
 
Domain Number 5 Region: 1136-1164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000357
Family C2HC finger 0.011
Further Details:      
 
Domain Number 6 Region: 339-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000166
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004035
Domain Number - Region: 296-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00421
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004035   Gene: ENSORLG00000003240   Transcript: ENSORLT00000004036
Sequence length 1170
Comment pep:novel chromosome:MEDAKA1:16:2927291:3014062:-1 gene:ENSORLG00000003240 transcript:ENSORLT00000004036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRRAQENPKSPKGPLEDGLEEEEEECVSEENEMLAKDEFSAEENFTAEFESGNMSCEDM
DYFCNKGEEDGNREAGEGETEGQGENGRHATVGPDEWDGPRELDAFLKDGERRIHSRQQL
PVGTTWGPFEGKIEMSTDTTALKTKSTVPVVLSAGPRWLLDVTWQGAEDNKNNCVVYSKG
GQLWCTTTKNMMEGEELVAFAVDFDSRLQAVNHMSLSEGMYPARLLDSIQLLPQQAAMAS
ILPTAIVNKDIFPCKACGIWFRSERNLQAHLMYYCSGRQREPETVVEDSDSGPHQSPSIC
PFPQCNKSFSGARALEMHLSTSHSGVKMEESLPPGTSLKCTICNYTADSLITFQHHIMSH
LSQAAFRCNHCHISFQSHRELLQHQDLHGHGSKLHREGDGTEHSPRGPEDSLQQQQPRAE
LANRKDALMGSPKGALSKETSTDGETDKAEKKPLLSAQKGEAHPGSKASFSYTRIKSEPS
SPRLASSPVQHNMPTFPMGPFLSQFAFSQDISVVPQASEILAKMSELVHRRLRHGGNSYP
PVIYSPLMPKGATCFECNITFSNLDNYLVHKKHYCNSRWQHMTKSPDFSALADKVSEAVS
PNSGHTSVSMLAGCHPAEADSHLMQSACLSSNMLDMINAGAKGPEKDLSGQVKKGSTPTG
TEDRLNGKQMEGKSPTTGLGDAENDPTKTTCDACNITFSRHETYMVHKQYYCATRHDPPM
KRMSNNKVPSVQRTMRTRKRRKMYEMCLPDQDHQRPPMGQPGFLGVPPMNPCTSQEAVES
LADRFQPRCDIFPGMVPKHLEASLTVTKSILAPKCNTVEQQELDAPIDLSKKCSPVPDKT
CSSPKRLLDYHECAVCKISFNKVENYLAHKQNFCPATAAAAAAAVAQQQQPQQQQQQGES
GNLEATAFPDVKSDGNNNPDDGYKSPGKCEKNGNGKVTVQNGGMFPPHLGPVPGLKPFTE
PQIVPSKEENKNMFLPHCLYPGAIKKMKGPEQISPYFGIKPTDYVSGAPAGQGEAGEPEP
SVNGGGGAGKTGTTREQTPQTAPNGCPHPGKEPLPLLPKNRGMVIVNGGHKPDERSGTAA
PQQENQPQPDTQPSNPSPTWAMENQADSNENMSPSSKSPSEEAAPAAIKGVNGSGSGKYC
RLCDIQFNNLSNFITHKKFYCSSHAAEHVK
Download sequence
Identical sequences H2LDM5
ENSORLP00000004035 ENSORLP00000004035 8090.ENSORLP00000004035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]