SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004048 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004048
Domain Number 1 Region: 124-152
Classification Level Classification E-value
Superfamily WW domain 0.00000000136
Family WW domain 0.0016
Further Details:      
 
Domain Number 2 Region: 173-202
Classification Level Classification E-value
Superfamily WW domain 0.0000000107
Family WW domain 0.0016
Further Details:      
 
Domain Number 3 Region: 9-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000146
Family HkH motif-containing C2H2 finger 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004048   Gene: ENSORLG00000003254   Transcript: ENSORLT00000004049
Sequence length 410
Comment pep:known chromosome:MEDAKA1:2:21966862:21972531:-1 gene:ENSORLG00000003254 transcript:ENSORLT00000004049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPRKFCQYCKCWIADNKPSIEFHERGKNHKENVAAKISEIKKKSIQKAKQEER
MSKQFAAMEEAAVKAYEEDLKRMERESQGGSFHPRAAPQHQPRKQQKKKEKMSRKPREQP
TARVWVEGFAENGHMYYYNTITGESQWEKPADPPGEPSTFVPPEVSHRSFSSAWMPAVSP
EGFTYYYNPETGESSWEKPADFSSGDPSGANKTEEESKEEPLAPQPEPLSGGAESSNGAN
QEEARVPEEASQQSTVPKISFRKRKAEPEPTEKEEEDKVDDDGPKEEEKEIKQEEEAKAT
TAEAEKIEEKATPVQAPVQTQPRRRRAANPYGAWEKVKQEKDPYANVDLQLPQVEASTAS
APTELPPEPKPKFKERIITSLGEEGGPASFRKPKSQNGKSRSLRQRDEDD
Download sequence
Identical sequences H2LDN7
8090.ENSORLP00000004048 ENSORLP00000004048 ENSORLP00000004048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]