SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004126 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004126
Domain Number - Region: 72-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00226
Family CHHC finger 0.041
Further Details:      
 
Domain Number - Region: 202-252
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00227
Family tRNA(1-methyladenosine) methyltransferase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004126   Gene: ENSORLG00000003320   Transcript: ENSORLT00000004127
Sequence length 487
Comment pep:novel chromosome:MEDAKA1:4:6379476:6389844:1 gene:ENSORLG00000003320 transcript:ENSORLT00000004127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFKYCYGAKNWARERGVGGALIMSVMASPLPNRCNFFLERKKRFCKMMVGKGQRFCGE
HANAAEGGSSRRIICPLDPKHTVAEDKLEKHLKKCNSRQKPKPIYYVENINAGPDDGDEG
LPQVCAQVSLSERSWSELELLLEKLKKASEGLQCEVEDNFLSHPALQEELVNPKNGDPAH
KHLKQQASILGHLDELGLLRRGRCFVEFGAGRGKLSHWIHEALKNNGDLKGSEDLQLLLV
ERSSIRFKVDGKHQDAGVQFERLQVDIEHLDLSKVPLLQDKKFPLVGVGKHLCGAATDLA
LRCLLETSRLRDPETEPPQKRLKPSEPAAEATPGDSGACSGASVSPVLGLAVALCCHHRC
EWRHFVGRQFFLERGLGAAEFSAFCRMSSWATCGVRAANQDYSSHHSTNQERAEEEHEPL
DETDTMNKFLSAVEREKIGRLCKRLIDSGRCHFLKSQGFSSRLTCYTDQGVTLENVLLTA
VPSSSSS
Download sequence
Identical sequences H2LDW2
ENSORLP00000004126 8090.ENSORLP00000004126 ENSORLP00000004126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]