SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004156 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004156
Domain Number - Region: 59-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000327
Family HkH motif-containing C2H2 finger 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004156   Gene: ENSORLG00000003343   Transcript: ENSORLT00000004157
Sequence length 124
Comment pep:novel chromosome:MEDAKA1:18:4038488:4064533:-1 gene:ENSORLG00000003343 transcript:ENSORLT00000004157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSEVQQLQPEPADEGKGSVMKNEQDELMTELKGNKRQQEPIGLESKRARSESPSVPGG
FLLPPYNPKSPIGQEHVVPKSGFFCNICSVFYLTEKAAKEVHCSSQRHYENLQKHNRKLQ
WKSS
Download sequence
Identical sequences H2LDZ0
ENSORLP00000004156 ENSORLP00000004156 8090.ENSORLP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]