SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004157 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004157
Domain Number - Region: 12-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0666
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004157   Gene: ENSORLG00000003345   Transcript: ENSORLT00000004158
Sequence length 424
Comment pep:novel chromosome:MEDAKA1:1:11654550:11659275:-1 gene:ENSORLG00000003345 transcript:ENSORLT00000004158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKKKKQMKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKE
TIDSVPNAIPGRTDIELEIYGMEGIPEKDMQERRRTLEQKSQESQKKKNNQDDSDEDDDD
DDAGPSVSQVPAVAPQASYAVPMTQPGMPPVAGVPHAGYQGMPPMMPGVPPMMHGMPPAM
HGMPPAYINNRIGSSCVVVINRMMPMGGMMPPMMPGMPGIPPAMPPHMAPRPGMPHVAPS
PAAGPIPSRPAVPVTQPAVAKPLFPSAAQMGSGVHSSTAAVSSPPADPQSASSQHPFRNM
PQFAQAQQNAPGAAASNPLTAAVTADPPKATFPAYTQPSVSSSSASSNPSSSTVVKPPAT
VTSKPATLTTTSATSKLIHPDEDISLEEMKATLPRYQRLIPRPGQALTAAAPSVAAVGGI
MPPQ
Download sequence
Identical sequences H2LDZ1
8090.ENSORLP00000004157 ENSORLP00000004157 ENSORLP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]