SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004187 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004187
Domain Number 1 Region: 68-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000591
Family Canonical RBD 0.0047
Further Details:      
 
Domain Number 2 Region: 274-370
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000129
Family Canonical RBD 0.0046
Further Details:      
 
Domain Number 3 Region: 190-223
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000445
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004187
Domain Number - Region: 737-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000193
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004187   Gene: ENSORLG00000003369   Transcript: ENSORLT00000004188
Sequence length 917
Comment pep:known chromosome:MEDAKA1:5:5681847:5694015:1 gene:ENSORLG00000003369 transcript:ENSORLT00000004188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMVLNRIGRTERSGRYGSEQSRDESDWRDRRERDQDRDHSMRHWSEERRFERYEGERRGT
RDSPEFELLDVSFQQRERKRRNSDRSEDGYHSDGDYPDQDYRREPGEDKKSKTIMLGGLA
PHVTEEDIRFSIDQLEGPQPVDVRLMKKRTGISRGFAFVDFYHLQDATRWMETNQKRLVI
QGKVVDMHYSHPRNKYEDWLCNTCGLYNFRRRLKCFRCGAAKSVSQKKLLFSVAFTSFNS
VGGKASTTLLDNQLLPKIPLESEVTNNTAVSETQPSGDFYGDTIILRNIAPLTTVESILT
ALAPYANLSANNIRLIKDKQTGQNRGFAFVQLSSPLEASQLLTILQGLQPPLKLDGKTIG
VDFAKSARKDLLLPDGNRVSAFSVASTAIAAAQWSSTQVIGGGMCRWTGPEQLTFPYSTR
AMNVLQDYQTYYHQGAATSTSQGNGLLGGTCFPTLMKSFFITTCSKVDLHYLIMTQMHIS
SGRYDQQDLRGIAMATHFREQRFISPQADPWDHLIESEKSSTAFCSGTQPEFCLFFFFYP
TAVPDISTYQYDESSGYYYDPQTGLYYDPNSHYYYNVQTQQYLYWDTEKQTYVPAPANIN
TEQNEKTADGSAASSSKEPKEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKSSFQPIS
QEERKEAAAADAGYSLFERKAGLDRLVHEASRMAEEEAPVSLAGASKCGLVAAYSGDSDP
EEGGAEPDGEGGQDKLTDWKKLACLLCRRQFPNKESLVRHQQLSDLHKKNLEVLRRSKMT
EAELEELERKESEVPKQKYRDRAAERREKYGIPEPPVSKKKKFSQPAPVIHPSNYEQPTK
DGLSSDNIGNKMLQAMGWKEGKGLGRNQQGITAPIEAQLRTKGAGLGTKGTNYTLSPSDT
YKDAVRKAMFARFTELE
Download sequence
Identical sequences H2LE20
8090.ENSORLP00000004187 ENSORLP00000004187 ENSORLP00000004187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]