SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004203 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004203
Domain Number - Region: 25-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00105
Family HkH motif-containing C2H2 finger 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004203   Gene: ENSORLG00000003384   Transcript: ENSORLT00000004204
Sequence length 89
Comment pep:known chromosome:MEDAKA1:18:4256525:4257099:-1 gene:ENSORLG00000003384 transcript:ENSORLT00000004204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRLVHLEGTQTRSGRVPARSILQPFNPNRSYGQEFTVPTKAFYCNLCSVFYMRETAEDDL
HCCSKLHYDKLREYFQKRAQLRKCSRKLR
Download sequence
Identical sequences H2LE36
ENSORLP00000004203 8090.ENSORLP00000004203 ENSORLP00000004203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]