SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004235 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004235
Domain Number 1 Region: 1224-1386
Classification Level Classification E-value
Superfamily PH domain-like 8.72e-72
Family Pleckstrin-homology domain (PH domain) 0.000000204
Further Details:      
 
Domain Number 2 Region: 1006-1226
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.0000000153
Further Details:      
 
Domain Number 3 Region: 432-529
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-19
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 825-901
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000626
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004235   Gene: ENSORLG00000003407   Transcript: ENSORLT00000004236
Sequence length 1521
Comment pep:novel chromosome:MEDAKA1:13:7097336:7133660:-1 gene:ENSORLG00000003407 transcript:ENSORLT00000004236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVESQNGYHGFYSTGRGYLSRKHMSRSLRISNKQPRRSRHASSGKIEHRNSETSTRSS
STPSIPQSLAENGLEPFNEADILPSFGSPIWVDRVAMSLRPLSFHNDLANPSVHMNTMHI
TLPGPTAEEAQDEDEYTADVKYLQKTCSKETVSFKKRSKSADMWRDDSLEFSLSDASQDH
LTSTEEIIDMANEGDFTDCEGHLQSIPTDSTDRANSLDELYSNTGPTRRQPHSRYAKWQD
TNKSVRESDDDKILSPSEEDGSSYGAYTLPCRRSHCLSEGLSTHEAATCASMQGRRAQTI
QDVTGGEGSEYEDSGIDGVMLGEEHQSRRYKTMSASFSVYSMHGRNMFAGSDSGSSGGGG
ATERVQGVYENFRQELEMSSCQTESIEEAGSALSDEQSTMTSAYQSDLLLSVVQGMVRKA
GKLAVKNFLVHKKNKKVESATRRKWRSYWVSLKGCTLFFYETDGRSGIDNNSIPKHAIWV
ENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTSSQTELENWITAIHSACAAAVARQHHRE
DTVRLLRSEIKKLEQKIDMDEKMKKMGEMQLSAVTDTKKRKTILEQIFLWEQNLEQFHMD
LFRFKCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTETGVRRR
TQATSRSCSKRRSRFSSLWGLDTTSKKKTKAHPSVSQVFADGEEFEKKPPECTYLDHVKE
NSKSKEETVNNLPRPNTESDIWLPDHLTPSWVCLPNDHPVLTIVQPGESALWVLESICKA
HELDPTKHYLRLKFLIENQVQFYIPKPEEDICDLLYKEIELCSKITKVIQFDRDESCMIG
YGFSISVVEEDGVQQLYITDVKAGGLAFAKGLNAGDEILQLNGKDSHSLNFSDMKAAFSQ
ASLALTVNTLPSVERRQLCYLPPRRSDAAEDLYNDPTLTLTCSPYHDKACKEERERERRV
GRNTSDRTTADREGAKKKKSTEQVAAFCRSLHDMNPLDCESSSPSPDSPFPPTATLRQLS
DADKLRKVICELVETERTYVKDLNCLIGRYLTPLQKETFLTQDELDVLFGNLPEMVEFQV
EFLKTLEDGTRLVPDLEKLERVDQFKKILFSLGGSFLYYADRFKIYSAFCASHTKVPKVL
VKAKSDANFKAFLDERNPKQQHSSTLESYLIKPIQRVLKYPLLLRELYSLTDPDSEEHYH
LDVAMKAMNKVASHINEMQKIHEEFGSVFDQLITEQSSEKKEVADLSMGDLLLHSTVTWI
NPPVSLGKWKKEPQLNTFVFKTAVVFMCKDASKQKKKMGGSHRLSVSSEEKDPFRFRHMI
PTKALQVRSLGNTDGENSAVCEIVHTKSESEGRPERIFQLCCSSPESRKDFLKTVHSILR
EKHRRQLLKTESLPLSQQYVPFGGKRLCALKGARPAINRAASAPTRTLGRRKLVRNRFTI
DTDIVFDRKSEADEQQQSEDGDTDRWVEEQFDLEEYEDQEDMKETDILSDEDEEFCQAPK
AQSEEVDLEAPLKALSLEGAE
Download sequence
Identical sequences H2LE68
ENSORLP00000004235 ENSORLP00000004235 8090.ENSORLP00000004235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]