SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004293 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004293
Domain Number 1 Region: 182-584
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-62
Family Hermes transposase-like 0.00066
Further Details:      
 
Domain Number 2 Region: 114-173
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.00000000693
Family Hermes dimerisation domain 0.0074
Further Details:      
 
Domain Number 3 Region: 25-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000298
Family BED zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004293   Gene: ENSORLG00000003455   Transcript: ENSORLT00000004294
Sequence length 587
Comment pep:novel chromosome:MEDAKA1:20:1936556:1938662:-1 gene:ENSORLG00000003455 transcript:ENSORLT00000004294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLAMAESNISEDVLVAEKKSTFVIWRYFGFRTGDVLQTQVLCITCRTPVATTRGNTSNL
HHHLQYNHEDLFKEFMTSRESKTPAKSEKKKSSAGQQTSVFQSFASGAPYEKTSKRHKEI
TEAISHFLAKDMMPINTVSRQGFVNLMDKMDRRYQIPSRNYFSQVAIPQMYETCRKTVTS
ELSQAGFFASTTDLWSSCTIEPYLSFTVHFLTADFELKTRCLETVYFPESHTSENIAHIL
LDVLASWELEEERQVCITTDNGPNVVRATELNKWVRLQCFGHRLHLAIERSIKDDARIAR
AIGLCKKLVGHFCHSWKAKTALKKAQKDHNLPEHTLVTECPTRWGSRQKMIERVLEQQPA
ISDVLSAGDALSGESYVSVSYVKTVLHLMKTSVLAEKEADGDLTKSIKKKILDYLITKYE
NPATQELLDMACFMDPRFKANYISTDQVSNIKTRVLSEMEAVAQKERISTDVEAQTNDPP
SAPLKKAKKTSPLPSSSVAQLSQAVEAELNSYLLSAPLDSEEDPLAWWKLHQITFSQLSK
LARKYLCIPASSSPSERLFSTSGNIVTCQRTCLKPTKVNMLVFLSKN
Download sequence
Identical sequences H2LEC4
ENSORLP00000004293 ENSORLP00000004293 8090.ENSORLP00000004293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]