SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004361 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004361
Domain Number 1 Region: 27-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000624
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 76-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000046
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 3 Region: 190-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000146
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004361
Domain Number - Region: 243-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000116
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 147-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0615
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004361   Gene: ENSORLG00000003503   Transcript: ENSORLT00000004362
Sequence length 368
Comment pep:known chromosome:MEDAKA1:8:5893327:5895267:-1 gene:ENSORLG00000003503 transcript:ENSORLT00000004362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEKAVGAGPQQVFTCTHAGCGACFPREWKLKAHETVHTGERPCACPTAGCGRLFKRT
SHLKRHVLQHKGVKGFQCKFANCAKSFIDAQRLKKHQNSAHGNHKFKCNQPKCSLTFKKR
RLLKLHLKEHNVHPNFKCSNIRCTATFDSHIARKAHEKKHAGYSCPHKDCQVVEHTWSKL
QRHLAKHPVSFTCGVCEKVYDKAGALRRHKRIHASHKPVLLCPRANCQAYFTTTFNLEHH
IRKVHLQLLKYKCFFPDCPRSFVMRESMHRHMVHHDPSAITAKKPQRPKKSWQKRLNGHN
QPFVEENLQRLFALRMRISRRAKVETNLAGLFNERKIPHFVDPEVNLRNLFGIKPPIPLE
SPAVAPVK
Download sequence
Identical sequences H2LEI9
8090.ENSORLP00000004361 ENSORLP00000004361 ENSORLP00000004361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]