SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004471 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000004471
Domain Number - Region: 203-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000571
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004471   Gene: ENSORLG00000003586   Transcript: ENSORLT00000004472
Sequence length 860
Comment pep:novel chromosome:MEDAKA1:2:22950936:22961062:1 gene:ENSORLG00000003586 transcript:ENSORLT00000004472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEQRRNFVSQPFHDGVYYPYTSDTHGTHSSAGIPSLLNSPLSQPSAPGMTPSSGVSSI
LPFKFRPRRESVDWRRINAVDIDSVVSQLDVDALQEHVSTVTFCSLDGERCQRCQSPVDP
ALIKLLQLAQLTVEWLLHCQDFLSLSLRAAEERMAAAGREREELLDQMRKQEEKLKNLTA
ELKQRKKVIRAQQSLLTPRIISSHKCAHCDKSFLNSAFLTNHMQRRHPDELSAQLQSDKK
SQIESLKLEIGALKEQIAQQQEALAAKIVQEKEQESVHKDLLRELGRMDRKIEDSRDGIR
REMELLYSRNIQALNVREGPSFSTLPPPLYSDSRFRLNFQEANQNQSKQEKQASPENPPP
ERDVDAFRDIHLQQMKKKEKKWQSRLQEMQAQHASEKNQLQDELSSMSEKLETSQREQQG
MKRRLQEQEQTIQAQGEQIKDFSLLPPNSPSITRKLLWVSVNRSPPAAEPKPKHVVLARL
PTTCSSCAALLEEPVSTLTLDPIQELSEEDKVKVSEQEDIQSNKLNSKAALKVGASVKRD
TRLELERSVAKKLESLGVKAKLSSLKSKELTSVMSKVRAKREMTAKKMPEYWRHHEEILR
IVEKKAFLSFPVVKIRPRSSSLPSTARQPRTPQPAPRTRTSTQPKTSTPNPKAPRVINDG
SFRDVFGRKQKLFFIASIRSHPFSSDESEEEDMEEEDASKPPTSRSHPPTRAGRFAPVLT
RQEEARPAADAVTRADIEDTESEEEEEETSINEMARKIEKFAERVVKKPAGGVSVLPTRK
DEVEEISLTDLEGGSDWVISKPASLHGSGPTRRSMDSPSTSVWGTSTGKGPKSDLTDAGT
GSTLKSSICSVSDLSDSDDF
Download sequence
Identical sequences H2LEU5
ENSORLP00000004471 8090.ENSORLP00000004471 ENSORLP00000004471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]