SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004743 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004743
Domain Number 1 Region: 33-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000488
Family HkH motif-containing C2H2 finger 0.045
Further Details:      
 
Domain Number 2 Region: 225-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000117
Family HkH motif-containing C2H2 finger 0.056
Further Details:      
 
Domain Number 3 Region: 296-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000193
Family Classic zinc finger, C2H2 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004743   Gene: ENSORLG00000003810   Transcript: ENSORLT00000004744
Sequence length 430
Comment pep:novel chromosome:MEDAKA1:8:5992114:6014024:-1 gene:ENSORLG00000003810 transcript:ENSORLT00000004744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAGTSAQGSPLLASLPVPGRPVQPQLDLKHLLPFRLNGTSPLSLFPNFNTMDPVQKAVI
NHTFGVPQPLKKKQIISCNICHLRFNSTNQAEAHYKGHKHARKLKAMETQKNRQRRAGDA
SSTVMDTSLAEGTSRTASITHLSTVLQSSAFAQSKQSSPPPTRQKCSPNPNNLSPPEISP
SSRVSETASDTSTVEVPEAPEAADGVGPSTESSSGVDSTNGEAQTDEDKEPKKSKAHLHC
PVCKVTVNSISQLEAHNSGTKHKMMLEGHSVLPRRRGKVVAARAAFKSKRLGSKGSVGLP
SKNFQCEVCEISVNSETQLSQHMNSRRHKDRLAGKPPKPKFTPHSKTQPGSSLATKLALQ
KQLTKSLTTGFLPSPLTQPALCTVATNPLALRHPVGTTTFIQTPFLGPALFRPAPGPLRA
THTPIIFSPY
Download sequence
Identical sequences H2LFK4
8090.ENSORLP00000004743 ENSORLP00000004743 ENSORLP00000004743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]