SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004748 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004748
Domain Number 1 Region: 24-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000816
Family HkH motif-containing C2H2 finger 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004748   Gene: ENSORLG00000003815   Transcript: ENSORLT00000004749
Sequence length 77
Comment pep:novel chromosome:MEDAKA1:8:6073268:6073498:-1 gene:ENSORLG00000003815 transcript:ENSORLT00000004749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEPCCEIEDHSAVLEQSPGGALHSSLFKPKRERKQRTYTLCEVCNIQLNSAAQAQVHY
SGKSHQKRLKKISNGKM
Download sequence
Identical sequences H2LFK9
8090.ENSORLP00000004748 ENSORLP00000004748 ENSORLP00000004748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]