SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004803 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004803
Domain Number 1 Region: 162-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-54
Family DBL homology domain (DH-domain) 0.0000741
Further Details:      
 
Domain Number 2 Region: 390-509
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000225
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004803   Gene: ENSORLG00000003844   Transcript: ENSORLT00000004804
Sequence length 514
Comment pep:known chromosome:MEDAKA1:6:8416004:8422109:1 gene:ENSORLG00000003844 transcript:ENSORLT00000004804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDTDDICPRTVENNKRTLRKMSTRTSTTSIISAAESSPPKPRSNSKKPPLQRGSSFTFL
TPGTPWDFTLKRKRKEKDDDTISLSSFDLKEPSNKRVRPLAKVSSLVNLMSPSKNGAVRR
FGQTIQIFVSLRADTKSPGTTLKGNSRSSGPTPTKRRNSTLWSETLDIHQKSTFSTKEIK
RQEAIYELFRGEQDLIEDLQLARKAYHDPMLKLSIMTEEELAHIFGDLDAYIPLHEDLLI
KLTEETGSDGTVAQIGQIVIDWLPGLNAYRNYCSNQLAAKALLDQKKQDRRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLREILRHTPPDHPDVTSLEKAIAIIQEILSDIN
VRKGESECQYYIDKLEYLDEKQRDPLIDNCKTLLCHGELRTKSGSRLHVFLFSELLVLTR
PVTRNDKSCFQVCRRPIPVKDLALEDLQDGEIRMGGSFRGAFTNGEKAKNVFRVSSMDAS
HCQSHTLHVSDVYHKQQWLNCLRTAIAQQQGASP
Download sequence
Identical sequences H2LFR4
ENSORLP00000004803 8090.ENSORLP00000004803 ENSORLP00000004803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]