SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004835 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004835
Domain Number 1 Region: 534-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.67e-18
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000312
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 486-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000349
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004835   Gene: ENSORLG00000003872   Transcript: ENSORLT00000004836
Sequence length 901
Comment pep:known chromosome:MEDAKA1:4:7149431:7192620:-1 gene:ENSORLG00000003872 transcript:ENSORLT00000004836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVNGFYCSEKDADAQPGEAEGTLMRGGQSLALPGGGQSNALYPHSLHCSRPGADLLLQDG
PQDTSPDRGCSAFHGTPAGASPSLGCGANRGCSSAAYPIKQENSAGYKISGAHGPSQTGF
QACRASQGLEASRDGMVDAARASSSKRACALRSLGSGVSGDAAQPFNNEDGSSPLALSPT
DSHHSARPLSASDVKRRCLLLASHSSTAAGSPSEAGAASDDLNLTAILCSSQMSMVAGVC
GFQANVSPCSTGFSSTSSSSSMSPPSASCPQGASQRPPPRRSPQQAMLQESCQLSSPGTC
LLSLSSFSSSSSESLVEPECQSSGLCEERGSVPRGRRAGGVGGARGSDGLGLLLTGTIMS
GTLHPGAEVGGVLDGVPRSGAALKQEPLDDFSPSEDELFQHHYQRHHHGPSGHLRQSHHT
PRSTMPPPYHLHQYSGAGPGGPLHPQSQPTASASSLGLKATVRGRHVPHTAPERDEAEGG
APAEKQVCRWIDCSAAYEQQEELVRHIEKVHIDQRKGEDFTCFWAGCIRRYKPFNARYKL
LIHMRVHSGEKPNKCMFEGCNKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDR
AKHQRTHLDTKPYACQISGCTKRYTDPSSLRKHVKIHSAKEQQVHRKELRPCPHLEQDVL
SNCLSMQQLQSSASSQPPFLGRNPTFSSCGEDILFTGLYADSNTPHHSASVELLAPNPAS
ITDLTPRQHRLDQDLESPHHLSPLTAMDGTRNGLLLVSFSSPVIFSPGKTPQQEWKLKIL
NNTKATFRAVSTLETPTGWSKRWMVSTPPETRTCTLPISTTASTCRPAARALQVRAVGGV
APTLSWTRLFPVCSRLRFGAGAPGRRRVSSVPLHFRGQPVLPGGQLEPHVVRLHRDMKRP
W
Download sequence
Identical sequences H2LFU5
ENSORLP00000004835 ENSORLP00000004835 8090.ENSORLP00000004835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]