SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004894 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004894
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004894
Domain Number - Region: 104-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.023
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004894   Gene: ENSORLG00000003923   Transcript: ENSORLT00000004895
Sequence length 315
Comment pep:novel chromosome:MEDAKA1:9:7036918:7040070:-1 gene:ENSORLG00000003923 transcript:ENSORLT00000004895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTKHSRVIFCDDSPKRVLVSVIKTTPIKPKKADALMPTSPGFSDFMVYPWKWGENAHN
VTLSPGSVNGAASPTGTQMAREADTAPSPDQIKDGIRRGRPRADTVRELISEGETSSSRI
RCNICNRVFPREKSLQAHKRTHTGERPYMCDYPNCGKAFVQSGQLKTHQRLHTGEKPFVC
SEKGCGSRFTHANRHCPKHPFSRLNREEPKVGPGKAQSADNKAVAEWLAKYWQTREQRAP
TTCKVKPQSKARAQDQEQQDPMEFTQSDEENEEEEVSVEEEKGSQGGAARRRLQEQRERL
HGALALIELANNLSA
Download sequence
Identical sequences H2LG02
ENSORLP00000004894 8090.ENSORLP00000004894 XP_004072263.1.28442 XP_020561455.1.28442 ENSORLP00000004894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]