SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004962 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004962
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004962
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily Orange domain-like 0.00157
Family Hairy Orange domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004962   Gene: ENSORLG00000003974   Transcript: ENSORLT00000004963
Sequence length 168
Comment pep:novel chromosome:MEDAKA1:7:7683315:7750345:-1 gene:ENSORLG00000003974 transcript:ENSORLT00000004963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARPVSLKSEAHAQKKKNKTQKLRKPMVEKLRRDRINTSIEQLKSLLSPEFLRQQPDSKQE
KADILEMAVTYLKNWQQQKQQQQNRLASGLMTAGDGYSHCIQEAVSFLTHSEAQTQAHRM
LLSHFQSLQGSSRTPLTLCSPSPPGSPLHQLSSTKGGSQASSGLWRPW
Download sequence
Identical sequences H2LG69
8090.ENSORLP00000004962 ENSORLP00000004962 ENSORLP00000004962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]