SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004968 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004968
Domain Number 1 Region: 292-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 325-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000579
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004968   Gene: ENSORLG00000003978   Transcript: ENSORLT00000004969
Sequence length 404
Comment pep:known chromosome:MEDAKA1:11:8839425:8840920:1 gene:ENSORLG00000003978 transcript:ENSORLT00000004969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMAALLGEEPRASSSNPLAMLAATCSRIGEPTLSYAPSPSDEAPGLSKGFYPWKGHVQGN
SFFNTCPTSLGVSSGTSRSNGMTETSAFSVTATSSSCNDFSMYQTPVPPSDSVLESAHAQ
RTMFLTKFPSHAESITGIYQRMHPYDSWLKPVGESVSSAWWDMGPTWVDPPNPAGLSSPL
SGYSSDYSSAFSPSAPQHLLPAAQHLFDDFRTPVPSPYSEPAAAAAPALTASPMVSLPAN
SRLSSRRHSGKATCDCPNCQEADRLGQGGSSPRRRGVHSCHIPGCGKVYGKTSHLKAHLR
WHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFECSVCHKRFMRSDHLNKHVRTH
TAEGSEDGGEPGLKSVNSDTDISGSGSPSQSPGAHENERAQGSE
Download sequence
Identical sequences H2LG75
8090.ENSORLP00000004968 ENSORLP00000004968 ENSORLP00000004968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]