SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000004978 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000004978
Domain Number 1 Region: 19-133
Classification Level Classification E-value
Superfamily SET domain 0.000000000441
Family Viral histone H3 Lysine 27 Methyltransferase 0.045
Further Details:      
 
Domain Number 2 Region: 339-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000818
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 1061-1111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000288
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000004978
Domain Number - Region: 1102-1146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000118
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 469-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000339
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 1385-1411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0235
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000004978   Gene: ENSORLG00000003984   Transcript: ENSORLT00000004979
Sequence length 1594
Comment pep:novel chromosome:MEDAKA1:5:6924974:6940507:-1 gene:ENSORLG00000003984 transcript:ENSORLT00000004979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVVESLEEIPAHVWKGLPASLNLGPSAINQNRIGVWATQGIPKGKRFGPFVGEKKKRSQV
TSNVYMWEVYFPSRGWMCIDATDPMKGNWLRYVNWARSSKEQNLFPLEINRAIYYKVLKP
IRPGEELLVWYTVEDNPEITAALEEERANSLNRKNSHRAKQDNSKARSKRNRGPSVMGIN
VALKQFESSSMALSATRCYDYYEAPARSSLTVPTCRCSFTSRENNSFSASPQTNEESAVK
KKKKLKTQICPEGNQGQPEEKFWKKPDRLVQGDDSQETAHQTSQQLNAADYTQSKQSGPS
CDGGSLAVSQVKLKSSSVAAHDPDFEPGGELESDAHGESYPCPHCERRFSTRQGLERHAH
IHGISYQQAQVFRCQYCNKSFGSQVGRRRHERRHEGGSKKRPGSLAGASSSLISPVAQTD
SSPDCTSPATHYIAIGFSGGHVQKPELQRKELGAGAERPLTLEENGESKELHPCKYCNKA
FGTHTNMRRHQRRIHERHLLPKGVRRKGMLFQEASMQQRPGESPSTSPPPVYVPSADTED
EADRDDYTVDISKNISENLSFYIDGKIVSTGAVSNCEVIEVDSRSAALFGLDTVIISPNQ
LSQALKVEARATSAKQISSSGQPAAKRRTSTPPLVTGLKVETETTPSSSSTSSKLLVGGI
FQQSTDSAAFQREKTVYLSPKLKQLLQTQDFQKSTITLITDSHRLTSPLAVSPLQGASGK
FKRRTTSPPSSPQLSPAGKTESCKGDALSAHTLKVPKLESHSVPPPEDVQDQDEDALSPS
GNVTHSQSSSGSGGNSCNQQPLDLSNSVGRQTDIVNKVLGDSALDLSLHCKSIVEPEIKG
NSAPQSLTKKRKPNTSMLEKVLMNEYASLTLPAEDGPFALAGLSRLSSCSPNVTSESAHP
SPPSLTPVTINPSSPGASSATSPTPPPPVLPTIPSPPAMPSSPRSQPSDSPAHRPLPVLS
PKMSPRVSLEAPPRPSAGPRSPEPTAEDLSSLEKVSHLASCSSKSSPSSPPVAQESSLSS
VSQSLCLIKVKEEPQDGVDSSPLPHPAKTSEAEEINSVYCKIFLCNVCEEPFNSIKELSA
HITEHAADWPFKCEFCVQLFEDAPALLAHRTTLHGVGKIFVCSACSKEFAFLCNLQQHQQ
DLHPNEACSHSTVENGKLRPHNYTDPSRAKEESSPSTPSQEQEPSVNGDHAEDSNEELYT
TIKIMASEGGKPRGPDVRLGINQHYPSYKPPPFPYHSRSHAGSVASATNFTTHNIPQTFS
TAIRCTKCGCSFDNMPELHKHILACASASDKKRYTPKKNPIPLKQIVKSPNGVVSPVVVA
GQSAFRRMGQPKRLNFNQDAVKTKMNALSKKRNQLVQKAISQRNKTAATAAKKSFVKTEA
ELASSVCPHCSREFTYTASLTKHMAVSCPMKPAVAKRGKKGLAEVKKEVISVLDKNTSKK
KPVDPEAQTEVEAKPLVKTRTRSSGGTNTESFQGSKRKAAAAVGRLKRTALSPVPVSPNK
RNKKSQTKTLPPTIPALDPPADGAPRPAVRTSRPAIGKKPAAMKLAETTQQLKKEERFSL
RMRERMGGPVTRSSQMANTLPPAEVKSEEASLEE
Download sequence
Identical sequences H2LG85
ENSORLP00000004978 ENSORLP00000004978 8090.ENSORLP00000004978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]