SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005007 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005007
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily POZ domain 2.36e-26
Family BTB/POZ domain 0.00068
Further Details:      
 
Domain Number 2 Region: 392-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000131
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 328-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000211
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 259-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000889
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005007   Gene: ENSORLG00000004007   Transcript: ENSORLT00000005008
Sequence length 555
Comment pep:novel chromosome:MEDAKA1:9:7688815:7696233:-1 gene:ENSORLG00000004007 transcript:ENSORLT00000005008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVEEVEATGGSEYPAHYKVMLEKLNEQRQLDQFTDITLIVDGHQFRAHKAVLAACSQF
FYKFFQDFTQEPLVEIEGVSNAAFRQLMDFTYTATLAVAGESEAFDVWKAAEYLQMQEAI
KALDKNRIHEFSSLTARSTSKKRKIAETSNVITETLPTVEGEQVEIQVIGEGPIEVEESG
LEEVVDAAKNAQASSDDSALALLADITSKYQQGEPTIQVIKREEIEEHEVVYQEETVTAS
KVLENVEVVEVQISQADNMFRCNKCERSFKQYSHLKQHIKSHLGSLERPHVCSHCGKAYT
REGALKQHINTFHFEAEELSQNQKPQKKVHVCEYCKKNFDHFGHFKEHLRKHTGEKPYEC
PDCHEKFARNSTLKCHMAACQNGAGAKKGRKKLYECQVCGSVFNSWDQFKDHLASHTGEK
PNHCTVCDMWFTHPKELTAHLKEIHLIVEKIPEQLVITDSAALTIAAQSLGGAETVLLDD
GIQVEHVTVEPVNVMELEETATVVVEDGGVGEMCEEDVERLKQAGLQIQVVHVTTADVQG
QQVVNSQVEAKMEEM
Download sequence
Identical sequences H2LGB2
ENSORLP00000005007 8090.ENSORLP00000005007 ENSORLP00000005007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]