SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005074 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005074
Domain Number 1 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 337-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000312
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005074
Domain Number - Region: 206-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00434
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005074   Gene: ENSORLG00000004056   Transcript: ENSORLT00000005075
Sequence length 419
Comment pep:novel chromosome:MEDAKA1:5:7137284:7146036:-1 gene:ENSORLG00000004056 transcript:ENSORLT00000005075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRGSKPAGKHCISSRMAEPRFNSPYFWPPPPAMPGQLDNLVLINKIKEQLMAEKIRQPHL
PAASSASQQPLLTPSQADGSQHGSSKAQQQMPALYSQSPSQPDIALHARPASSSVTGVAL
ASRTGNLSTSEILTPTTPTSSSQSRLCGSSTPHFISGLAAGRGIEGGKSNGGLLGLLGPP
PKLERGRKKIKAENGSSLLVVPYPILASGNDQPCVGISAKEGKTYRCKICPLTFFSKSDM
QIHSKTHTEAKAHRCPHCTKTFANASYLAQHLRIHLGTKPYRCSYCEKCFRQLSHLQQHT
RIHTGDRPYKCAHPGCEKAFTQLSNLQSHQRQHNKDKPFKCSNCYRAYSDSGSLQIHLSA
HAIKNAKAFCCSMCGRAYTSETYLMKHMSKHGMVEHVMSHHSPLHRTDSPSIPIRISII
Download sequence
Identical sequences H2LGH8
8090.ENSORLP00000005074 ENSORLP00000005074 ENSORLP00000005074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]