SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005382 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005382
Domain Number 1 Region: 864-916
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 221-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000185
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 837-873
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000294
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 155-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000069
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 5 Region: 554-598
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000244
Family Homeodomain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005382   Gene: ENSORLG00000004296   Transcript: ENSORLT00000005383
Sequence length 997
Comment pep:novel chromosome:MEDAKA1:20:4925475:4938135:1 gene:ENSORLG00000004296 transcript:ENSORLT00000005383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNYNNVVEAGSDSDDEDKLHIVEEDGADCDGTLQDDEHQGVLQWDPEILPEGSDRGKPA
GWACDEEEEHRQIQHQPSSPEQCESEASPKGVKEDCPSNGEDDVSTDALVEKMLQQGDTA
VIYPEAPDDEPPRQGTPDTGVHDENGTPDSFSQLLTCPYCSRGYKRYSSLKEHIKYRHEK
TDESFSCPECSYSFAYRAQLERHMTVHRNGRDQRHITQSGGNRKFKCTECGKAFKYKHHL
KEHLRIHSAGEKPYECSNCKKRFSHSGSYSSHISSKKCISIISMNGRQRVGGAKTQGPSP
TLSTSPSALCTQIREKLEHTKPLQEQLPLNQIKTEPVDYEYKPALGTPPNMTAMSGGGVF
AGGAAAPLQGTVQAVVLPTMGLVSPISINLADLQNALKVAVDGSVIRQVLENKVQASAGL
TTGTLHPPQQQLISAISLPIVGQDGNAKIIINYSLDPSQGQLTAHNLKKEREETLSPYLQ
KLPEDLTVRGPKPPEIKEEKTTKNCLLCENCPGGLEALHALKHCKKDVLRLNGAGRDRSE
SAIAALLSEGGFCHPSKNILSLLKAYFALNAEPTKDELAKISDSVSLPVHVVKKWFDKMQ
EGQISLGAPTPPSEEEDTCEAHSVVSLIPGGDAATKSPSVSRDSPTEATPAEVNGTHSFP
ASPTPLNLTAGGPVQAVTPQSTEGPLDLSLPKPAREEAERVAVKAPVFLSASSGSPKQEQ
PLNLTCTKNNASPLSSTWGSPAALHAHQPSAKHLDIVTTMQCLRALATNNKQAILIPQLA
YTYTTAASSPAGSETHDGVHINGIKEEKPDLSSEANSMLEEQNDSDSGPARKKMKKTESG
MYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICSKAFKHKHHLIEHMRLHSGEKPYQC
DKCGKRFSHSGSYSQHMNHRYSYCKKEAQSQAAGQESPEDGEALSRVQSELFPPSLLDLD
ERGSSTTPGSPEKDEAMETEENEGETKDNKETKGDTD
Download sequence
Identical sequences H2LHC4
ENSORLP00000005382 8090.ENSORLP00000005382 ENSORLP00000005382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]