SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005524 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005524
Domain Number 1 Region: 9-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.19e-68
Family Eukaryotic proteases 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005524   Gene: ENSORLG00000004405   Transcript: ENSORLT00000005525
Sequence length 286
Comment pep:novel chromosome:MEDAKA1:4:7865962:7874433:1 gene:ENSORLG00000004405 transcript:ENSORLT00000005525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRLCPLPCVHVLYHIQGSVIVNGELAPEGSMQFMVSVQNENGHECGGFLISEDFVVTA
AHCDNGLKHVILGGHNWKNSNVKKIEISNQCKHKNYSDVGNGYDIMLLKLANKAPMGRNI
KTIPLAKKNMKLSVNQVCSVAGWGKMVSTGGLVDDLMVVNVSIIDHNDCKKSWGKLPPNM
ICAGGKYTDKGFCQGDSGGPLVWNGKAVGIVSFNKNYNCKYPDVPNVYTDIREYVDWINN
ITKNKMCPIHSFTEANENGLDVCSNLFAISLSLDSSLVPLSCSIAN
Download sequence
Identical sequences H2LHR0
8090.ENSORLP00000005524 ENSORLP00000005524 ENSORLP00000005524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]