SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005616 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005616
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily POZ domain 6.67e-26
Family BTB/POZ domain 0.00091
Further Details:      
 
Domain Number 2 Region: 589-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000501
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005616   Gene: ENSORLG00000004474   Transcript: ENSORLT00000005617
Sequence length 659
Comment pep:novel chromosome:MEDAKA1:10:11900071:11902050:1 gene:ENSORLG00000004474 transcript:ENSORLT00000005617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFQHIFSQLNHQRLHAQLCDCIVVVGDQTFRAHRSILAACSSHFRALISSCDSAD
GGSEADTSAGNRDPCVMALDPEVVTPEAFSILLDMIYTSTLSLEASSAMDVLLAASHLHL
NTVVKACKLHLSRKNFPTSAPKGWRSVKKQCQCPCSQAAAGSQQLIILDLDDEEEGEEVS
QSGGDKESCGSREQSLETSLRQKRKSEDRPNDRKRFHRLPGANYKERSPTVTRSTEEKRG
EETSSQDSPPKSNGIWGNQGFDEDEEKYEAMKGESEEVQLPTQSDSTTGGTLWGNSEDMD
GNPVVKVKVGKEEEEEELKMQILEVKKENVSAYSSDPETLPNNSLPSPLHDCTNHTDVHL
NDEKVSMCGHAGGDLPSLHTDGQTDAQRQVGDLGEVSVDGEGLDSLSELAFSCFLNPSSE
MDSLEEEEDSLASLTAVATAAAAASDAPTADEQEEKLEETGEPSTQPSDSSSLVFPVTNV
PLQQFLQPTQNTGFSDTIILQPTQNSFTGFLSGIGSGLSLENAVVQPARSGKSSGTTFRR
IAPKVPPGSESVTEPAGEAADRPTLTKASEDVLSKCKKAAAEDHVLLVEGEKKYACKICC
KTFMNLTDCKKHIRVHTGEKPYPCQKCGKRFSQSSHLYKHSKNTCLNWKEGPSFADTLL
Download sequence
Identical sequences H2LHZ8
ENSORLP00000005616 XP_011478728.1.28442 ENSORLP00000005616 8090.ENSORLP00000005616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]