SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005644 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005644
Domain Number 1 Region: 172-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 828-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-17
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 135-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000173
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 215-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000715
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 868-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000259
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005644
Domain Number - Region: 85-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0018
Family Classic zinc finger, C2H2 0.066
Further Details:      
 
Domain Number - Region: 277-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00622
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 46-69
Classification Level Classification E-value
Superfamily SET domain 0.0275
Family Histone lysine methyltransferases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005644   Gene: ENSORLG00000004492   Transcript: ENSORLT00000005645
Sequence length 1164
Comment pep:novel chromosome:MEDAKA1:7:8204389:8223638:-1 gene:ENSORLG00000004492 transcript:ENSORLT00000005645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVDDMGNIKFELDTGLDTTANSWLKYVRSAPSFEEQNLVASHLTGDQIYYKAVRDIEAG
EELLVYMKDGIFPEGSMAPNLQDEQMYRCEDCDELFSSTLELRRHQKYSCSSAGSIFDAL
RDDFKQEREDSDEPVHECKDCEKIFPNEYSLGQHMIVHTEEREYKCDQCPKAFNWKSNLI
RHQMSHDSGKRFECENCDKVFTDPSNLQRHIRSQHVGARAHTCPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQLFSTTSSLNKHRRFC
EGKNHYGSPAGMFNPGIPMSSSPIMAKTKSHHPHLTGLNQSSLGFTDYFPSRPHPHSGLP
FSPGPHGFPSLPHGFPGIFPPSLYPRPTLLPASPLIKSPLGASSQEVKLPRSPIGAPPLP
LVSSTNSNGVSSLGLEDKDKEIKLELSSSGEVKPKSKITDISDGSDLEDVNTTSGTDLDT
TTGTASGDGSDLESEGESERERSGKRRKPSGTASSSGNLSIDRPFLGSGSSQHSFFPPPD
EQAIPPTSTNTNAATTDSIKAIASIAEKYFGPGLIGLHQEKKMGPLPYHSMFPFQFLPNF
HNSLYPFSTDRNALNPSMFFKPEPKSPRELLHKTISGPPAAPASTAESPFDLTTKTKEAK
LIPPTPANPSNPEEQPLDLSIGSRNRSSHNGLHAELQSRKNHMYGPGKSVFNKSLHQSSL
TQHQQSQPHQPPPLHYAKPSAFFMDPIYRVEKRKLLDPVGAVKEKFLRPSPPLFHPQMSA
MENMTEKLESFGALKLDAPPNSLQHSAHPLFNFRSPPPSLSDAILRKGKERYACRYCGKI
FPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQ
QTNLDRHLKKHEHENIPVSQQSGILSNLGTTISSPNSEPDNHALLDEKEDSYFSEIRNFI
SNSEMNQASSSTDKSHSLNELCQSPRFPPASSSITPSPPFVNTHYGQQSHWMEDGSLTEK
SHDEAPESPSPVTTGVYEEDDEEDDGESAPLAMNYEHTRRCVEEEGSLLDLESLPTFPKS
VDGLRKAATEEQPFDVKDIFNTSLESEALKETLYRQAKTQAYAMMLSLSENNPLHAPSQS
SLDAWLSMGGGPSETSSFHPLNHI
Download sequence
Identical sequences H2LI26
8090.ENSORLP00000005644 ENSORLP00000005644 ENSORLP00000005644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]