SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005670 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005670
Domain Number 1 Region: 106-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000612
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 55-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000398
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005670   Gene: ENSORLG00000004512   Transcript: ENSORLT00000005671
Sequence length 307
Comment pep:novel chromosome:MEDAKA1:6:9137533:9155075:-1 gene:ENSORLG00000004512 transcript:ENSORLT00000005671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDGEPLSRMDSEDSISSTLMEMESTASSGRSTPAMMNGQGSARSSGNKTMAYTCCWD
LCPQCFNSSPDLAEHIRGIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDK
PFKCVVGGCNASFASQGGLARHVPSHFSQQSSSKMSSQAKLKEESPSKAGLNKRKKLKNK
RRCTLHSKKPYFSGTTLSYLATAVVCSNKSKDNLAKGQESVFYHSAKVLARRKEGSGKVK
VLLHWTPEDILPDVWVNETERSQLKTKVVHLSQLPQDTAMLLDPNIYRALPQKRLKRRYF
CIMSYTH
Download sequence
Identical sequences H2LI50
8090.ENSORLP00000005670 ENSORLP00000005670 ENSORLP00000005670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]