SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005672 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005672
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-70
Family Eukaryotic proteases 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005672   Gene: ENSORLG00000004510   Transcript: ENSORLT00000005673
Sequence length 256
Comment pep:novel chromosome:MEDAKA1:4:7962610:7964348:1 gene:ENSORLG00000004510 transcript:ENSORLT00000005673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGKPDCTCANLCCRASVDRLVFCVLGAAGSHIVGGRDAAPHSRPYMASLQVRGQHICGG
ALVREDFVLTAAHCDLPIPFTVVLGADLLQENEPSRQTFRVLRSIPHPNYNELSNDIMLL
KLDGRARLTPEVQVIPLKSGTVGPASQCITAGWGDIGDNRTIANRLQEVDVTILAQRTCR
QRWGNVRVLRSMVCGVGARSFQGFCSGDSGGPMICDGEAAGIVSFSGRRCGDPSTPDVYT
RISSFRSWIITQFNNN
Download sequence
Identical sequences H2LI52
ENSORLP00000005672 ENSORLP00000005672 8090.ENSORLP00000005672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]