SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005725 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005725
Domain Number 1 Region: 135-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000101
Family Classic zinc finger, C2H2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005725   Gene: ENSORLG00000004557   Transcript: ENSORLT00000005726
Sequence length 265
Comment pep:known chromosome:MEDAKA1:8:6961438:6983022:-1 gene:ENSORLG00000004557 transcript:ENSORLT00000005726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRFSRFNEERDFQGGNHFDQYEEGQLELEQASLDKPIESDNIGHRLLQKHGWKLGQGL
GKTMQGRTDPVPIIVKYDVMGMGRMEMELDYAEDATEKRRVLEVEKEDTEELRQKYKDQV
EKEKAIAKALEDLRANFYCELCDKQYTKHQEFDNHINSYDHAHKQRLKELKQREFARNVS
SRSRKDEKKQEKMLRRLHELAEQRKQDKQNRTPGSGPMFKTTTVAVDGEKLEDGDNMAVE
TPVLTDAILEAAPLEKTGQSSPKPG
Download sequence
Identical sequences H2LIA3
8090.ENSORLP00000005725 ENSORLP00000005725 ENSORLP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]