SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005800 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005800
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily RING/U-box 5.72e-16
Family ZZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005800
Domain Number - Region: 76-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0384
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005800   Gene: ENSORLG00000004614   Transcript: ENSORLT00000005801
Sequence length 302
Comment pep:novel chromosome:MEDAKA1:12:7554285:7560930:1 gene:ENSORLG00000004614 transcript:ENSORLT00000005801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHEGVSCDACLKGNFKGQRFKCLICYNYNLCASCYKSGATTTRHTTKHPMQGILTKVN
YDLYYGGDTFSVEQPQSFTCPYCGKMGFTETSLQEHVTSEHAETSTEVICPICAALPGGD
PNHVTDDFTAHLTLEHRAPRDLDESSSVRHVRRMFHPGRGLGGPRARRTNMHFTSGSTGG
LSSSSSQSSTYTPSNREAMDPIAELLSQLSGVRRAAGGQINSSGPSASQLQQLQMQLQLE
RQQAQAARQQVESGRHAARRGNNPSNSGTAIPPPSTATVTTTNVGEMNPPSSSHSSQFLL
SR
Download sequence
Identical sequences H2LIH4
ENSORLP00000005800 8090.ENSORLP00000005800 ENSORLP00000005800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]