SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005803 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005803
Domain Number 1 Region: 523-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000277
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000005803
Domain Number - Region: 562-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000313
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 844-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0097
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 725-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0543
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005803   Gene: ENSORLG00000004620   Transcript: ENSORLT00000005804
Sequence length 882
Comment pep:novel chromosome:MEDAKA1:7:8658140:8661001:-1 gene:ENSORLG00000004620 transcript:ENSORLT00000005804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISENLTFNIDGKTVPTRNVSNCEVAEGQCGSSAVVGFEMSNVLSTDTEPPDLQHSKRNTT
THPLSPKTRTDLESELAVTSSSSPPFVPPVIQSSYPQNSEFTDEQKQITGFLTPNLKQES
LKPTHVVITDTQKPSSPVTFSVLPSGRFKRRTSSPTTFPQLNLASGEGTAAPDTGDVVAA
NTGLQGSCTQQTMNDCMIPCVGEQAPKPALMDRQPSVTGGNSCNQRPLDLSNTVKANDSA
SAVLDLSLQKSIHSGSELSLNLGEKALKQTGKEKESQGLKSPIITLLTASEIVTPVEPVA
EGLVYGLTLSPPSLPPPSASFGPVALESASPCTIAFASPVAHSMLPTAPSLITVLAPPPV
SNPLCQPIQVMAPDISYNIASNAVLIECTIALDGPRTVVPAAVNPPEDATDFTTPTQMVV
NPIKHLLPDPETVHPSIMVSSAAESLTLPANAEVMSGNSVVGESNCEAVPVVNPESPAGK
DEDAADKSVALSENALEMTSSLPEKAEEPVHNTIDVQEQTFTKNFICNVCDKLFHSMKEL
GHHVGDHADEWPYKCEFCVLLFGKPSALLDHRSSLHGVGKTYVCCACTKEFVYLCNLKQH
QEELHPGQPCTYTEDEKGKLRPQNYNNSTKVNTDPPAAKSLQEPSDLVKKEKSEVDVAAE
ELFTTIKIMASDGGKVKGPDVRLGIYQHYPSFKPPPFPYHNRSPAGSVASATNFTTHNIP
QTFTTAIRCTKCGKSFDNMPELHNHILACANASDKRRYTPRKNPIPLRHFAKAQNGVLWI
TNSSNGIKASIRVSPASRSKPGQESPVKLRILKKKKKKLVQRVLPQRNKSVSSSNKASPP
QVDRQQEVFVCPHCSREFTMRRSRTKHMAVCPKKPTEMTKRK
Download sequence
Identical sequences H2LIH6
ENSORLP00000005803 8090.ENSORLP00000005803 ENSORLP00000005803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]