SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005900 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005900
Domain Number 1 Region: 337-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 235-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 380-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000757
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 214-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000437
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005900   Gene: ENSORLG00000004688   Transcript: ENSORLT00000005901
Sequence length 434
Comment pep:novel chromosome:MEDAKA1:7:8818855:8826717:-1 gene:ENSORLG00000004688 transcript:ENSORLT00000005901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPRFNNPYFWPPPPSMPGQLDNLVLINKIKEQLMAEKIRPLHLPPTSAASQQPLLVPT
SFFKVPSQPGDWWRVAASVSSVGGGQSQQQWRSWSSAGAKTQTKVQTHITQHMRLAPSRP
DSHSTSEALTPTTPTSSSQNRLGGSPSVNIISGLASGPGKINKLNTPTTLTKTQAESKLR
FIYKVESSADSHPLEQVQPKGILTPTYTCFPSTRCKVCPLTFLTKSEMQIHSKSHTEAKP
HKCPHCSKTFANASYLSQHLRIHLGIKPYHCSYCENSFRQLSHLQQHTRWAWRSCCPHSV
NSLRLSLFLLAHFKDPLQLEWKRFLSSFHRRTKRLTFNFKKHNPIHTGDRPYKCAHPGCE
KAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHLSAHAIKNAKAYCCSMCGRA
YTSETYLMKHMSKH
Download sequence
Identical sequences H2LIR8
ENSORLP00000005900 ENSORLP00000005900 8090.ENSORLP00000005900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]