SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006045 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006045
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000176
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006045
Domain Number - Region: 48-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00131
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 90-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00244
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006045   Gene: ENSORLG00000004805   Transcript: ENSORLT00000006046
Sequence length 276
Comment pep:novel chromosome:MEDAKA1:16:6783633:6785120:1 gene:ENSORLG00000004805 transcript:ENSORLT00000006046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFKTKITLKGHRLSHTDEGKQFKCLECDFTSILKASLLRHMEQHAKFKPFRCARCHYSCN
STGALKRHYNMKHPHQTYENAGPGLPNSDILKEQGGMKCPECEFVYGTKWELNRHLKSKH
NLKVVEGPLEVKALCAAGGLGMQMQVETQYVSVEGEEHLTEAPVAVLEQNDVFTQNYINV
CVFISVNIHQVAEFSSETQDAVTSMVAMGPGTVTVVQQVAGEQEVTECSDQLMVVNADGV
PEGNQVMVVEDAHGLEALTVLTQGENTHHYIVYVQE
Download sequence
Identical sequences H2LJ60
ENSORLP00000006045 ENSORLP00000006045 8090.ENSORLP00000006045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]