SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006128 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006128
Domain Number 1 Region: 42-161
Classification Level Classification E-value
Superfamily TPR-like 1.9e-22
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 2 Region: 854-894
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000774
Family HkH motif-containing C2H2 finger 0.068
Further Details:      
 
Domain Number 3 Region: 777-810
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000377
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006128
Domain Number - Region: 911-941
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00121
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 640-671
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00314
Family CCCH zinc finger 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006128   Gene: ENSORLG00000004865   Transcript: ENSORLT00000006129
Sequence length 980
Comment pep:novel chromosome:MEDAKA1:8:7585201:7599623:1 gene:ENSORLG00000004865 transcript:ENSORLT00000006129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGACRDRRSRWQEIQEGLQFIQSTLPFPGSQDQYEVFIKELVWNLFGEGNDVFKEGEWT
KSIEMYTEALSIADYADSEEICVSAGLLEKLYANRAAAYLNIGLYDQALEDCEKALHLNE
GNYKALYRKAKALKELGRHQEAYEAVAKCSLVVPQDSNVTQLTQDLAKILGLKIRKAYVR
SKESNILAPGPAPIQPPLTVHIPLNDSAVDEPPPSNSILSAPPTEPPGFESLSLSAPPSV
PLHGLTYVNGCRTNKPSPIFEPNQDFDADIIGDDLDDLLDQAGPESLSVSRCDPKTRQRG
LFKLMCDVFSSLYQDIPTVKGPLPLPTSIGSGSSMSSPFLMPAHINPFLSSGSQQCTVNL
PPLYHKSGSSTYLGMDTFQRLSQPLDSLDSLTISDYKTGNKFSLCSFNFFLLQLSNDEPP
MGMAVGMPDVKNLPAAVDLAKNPLADTHEFRQACAMCYVKTGPGVLDYTLHTEEHKCKKD
VLLGRMKHSPDKMWKLIRPRPTKTQYVGPYYICKEVAVGKECLYPGHCTFAYCQEEIDVW
TLERKGFISRELLFDPFGPNSNIRLTVPKILQEHRGIFMFLCGVCFDHKPRIISKTNKDD
PLLCSHPVTKHDFEDHKCLVHILKETTVCYSKIRPLTPQSQLDLCRHEVRYGCVREDDCF
YAHSLVELKVWMMQHERGITPEEIVQEAKRYWNATASLQGTQLSMVPRRFGPPNLKMMFV
CGQCWRNGQLSEADRNKKYCSAKARHQWAKDRRVVLVSSHERKKWTTVRPLPTKKPIPSQ
FEICMHVTAGKKCQYIGNCTFAHSVEERDLWTYMKENNIPDMDQLYERWLQSQKPGWSED
TSNNSVRENGKQIHMPTDYAEEVAGNHCWLCGKNCNSEKQWQQHITSEKHKERVFNSEDD
QNCWQYRFPTGTFKVCERFLKGTCTEDDLCKLAHGEQELREWRERREFLLMKLAKAKKDH
LIAPNDNDFGKYSFLLKDIK
Download sequence
Identical sequences H2LJE0
8090.ENSORLP00000006128 ENSORLP00000006128 ENSORLP00000006128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]