SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006161 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006161
Domain Number 1 Region: 22-141
Classification Level Classification E-value
Superfamily POZ domain 1.26e-26
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 508-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000244
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 413-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000868
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006161   Gene: ENSORLG00000004895   Transcript: ENSORLT00000006162
Sequence length 683
Comment pep:novel chromosome:MEDAKA1:13:10334845:10337082:-1 gene:ENSORLG00000004895 transcript:ENSORLT00000006162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFYRSCFFFSGGGLKTMLDAMDVPSHSRDLLLQLNSQRTKGFLCDVIIVVQNALFRAHK
NILAASSLYLKSLVVHDNLINLDHEMVSPGVFRVILDYIYTGRLSEGDPTSPTEPNLGAV
LAAASYLQLLDLVALCKKKLRRIGKYPQRQAPAFLPYAKMGPNSMGFGSRYRVSTPVIQS
CPPGGLLNTPRPHSLEDMVPHRLSVHTGEIYAPTSNQGSQGRSAHERNCSPSFGLDLSKK
SPTTQSQFTPSQTRLANSHNEEERDGTQSGRTSPMTGTRSPPAFPHLNQPLGPHLPHLHR
SGSQGTDRYPCPPSPETPTEGGEAGRETGNIYRWVKHEPLPYPAEDEDEDEDEEEGGENG
EQHHNHHKAGEESEGGDDKSGSGTEETGSSEGRPSPSGPMGRFHMPYEPESFGDNVYVCI
PCDKGFPSSEQLNAHVETHTEEELYGNPGGEMNKSTHGLNSGGIAELIRPYRCSTCEKSY
KDPATLRQHEKTHWLTRPYPCSICGKKFTQRGTMTRHMRSHLGLKPFACDSCGMRFTRQY
RLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHSNGGTGGGLTTDGKLKLDFSEGI
YPLSKYAAEHLGLKQEKASELLIQAQQQLVADAKAIESLYPLSKLASEHLGLTHDKMDVL
GQPLPPPLQALSEGRTIDRYSPS
Download sequence
Identical sequences H2LJH3
ENSORLP00000006161 ENSORLP00000006161 8090.ENSORLP00000006161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]