SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006175 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000006175
Domain Number - Region: 44-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000595
Family HkH motif-containing C2H2 finger 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006175   Gene: ENSORLG00000004906   Transcript: ENSORLT00000006176
Sequence length 121
Comment pep:known chromosome:MEDAKA1:17:5817094:5826983:1 gene:ENSORLG00000004906 transcript:ENSORLT00000006176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYIQEHNSYDDVTAAFLQEVMLSKSLQCSRAIEDSALTALQENDHMTKVEMFHCAACKL
LVPTSGADVKAHITSVDHLRNTKEFEEQQRRACLSKAETLMKELKPQFEHFLNVLKLNGQ
T
Download sequence
Identical sequences H2LJI7
ENSORLP00000006175 ENSORLP00000006175 8090.ENSORLP00000006175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]