SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006232 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006232
Domain Number 1 Region: 356-464
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 
Domain Number 2 Region: 235-340
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 25-131
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 4 Region: 130-234
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 5 Region: 465-537
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006232   Gene: ENSORLG00000004947   Transcript: ENSORLT00000006233
Sequence length 537
Comment pep:novel chromosome:MEDAKA1:20:7547142:7569927:1 gene:ENSORLG00000004947 transcript:ENSORLT00000006233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDVDRMFSVNSNSACASILARIGGSQIRLVGSGSTRCSGRVEVLHDGVWGTVCHDKWSIN
DAKVVCRQLSCGTALHAPRSALFGQGSDKIWLDDVECSGSESSLTQCGHNGYGKHNCNHG
EDAGVICSGEIRLAGSGSTCCSGRVEVKQNGSWATVCYNGWDLNDANVVCKEMGCGPALT
ATESAGFGQGSGQIWLKNVTCSGSEMSLTECSHRVFEKHQCNHSKDAGVICSGRTEIRLV
GSGSTRCSGRVEVQHNGVWGTVCEDDWDLNDANVVCRQLSCGTAVHAPGSAHFGQGSGPI
WLDNVACSGIESSLTQCGHNGYGKHNCGHGEDASVICSGEETSYIIENPLLFLTYCSEFD
QIRLVGSGSARCSGRVEVQHNGSWGTVCDNDWDLNDANVVCRQLSCGRALQAPGSAHFGQ
GSDKIWLDDVACSGNESSLTQCGHNGYGKHNCNHGEDAGVICSDQIRLVGSGSTRCSGRV
EVQHKGSWGTVCGDEWDLKDANVVCRQLSCGTALQAPGSAHFGQGSDKIWLDNVACS
Download sequence
Identical sequences H2LJP2
ENSORLP00000006232 ENSORLP00000006232 8090.ENSORLP00000006232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]